PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.I6LH9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 318aa    MW: 36668.1 Da    PI: 6.4387
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.I6LH9genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-52211451128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhP+deelv++yL+kk++++++ +  +ike+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ +   +
  Araip.I6LH9  21 LPPGFRFHPSDEELVNHYLCKKCAKQSIAA-PIIKEIDLYKFDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGK--PK 115
                  79*************************999.88***************7666789*************************************98..77 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  + g+kk Lvfy g+apkg+kt+W+mheyrl
  Araip.I6LH9 116 ALGIKKALVFYAGKAPKGVKTNWIMHEYRL 145
                  8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-6215174IPR003441NAC domain
PROSITE profilePS5100559.87321174IPR003441NAC domain
PfamPF023651.9E-2722145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
SFSRNQEQEE EGGIMQGGLE LPPGFRFHPS DEELVNHYLC KKCAKQSIAA PIIKEIDLYK  60
FDPWQLPEMA LYGEKEWYFF SPRDRKYPNG SRPNRAAGSG YWKATGADKP IGKPKALGIK  120
KALVFYAGKA PKGVKTNWIM HEYRLANVDR SAANKLNNNN LRLDDWVLCR IYNKKGKIEK  180
FNSATTGLEQ KLPKFSPGEI LHYDHDHEHE TKPKIIHNFS NNEHQLYMDT SDSVPRLHTD  240
SSCSDHAVSP DATCDKEVES NPKWSNELDM QLFDTFDFQL NNYDNSLPMN DDDLFGNQFQ  300
MNQLMSFQDT FLFPQKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-811918013174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016171224.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-121NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A151T4971e-158A0A151T497_CAJCA; NAC domain-containing protein 2
STRINGGLYMA04G38560.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-117NAC family protein